PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_29914_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family MYB_related
Protein Properties Length: 442aa    MW: 49661.3 Da    PI: 7.6276
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_29914_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.5e-09340381346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +WT+eE e++ d  + +G++ +++Ia+ +   +t  +c+++++k
   Neem_29914_f_1 340 PWTPEEREIFMDKLATFGKD-FRKIASFLD-YKTTADCVEFYYK 381
                      8*****************99.*********.9**********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-15324386IPR009057Homeodomain-like
PROSITE profilePS5129314.947336387IPR017884SANT domain
SMARTSM007171.3E-8337385IPR001005SANT/Myb domain
PfamPF002494.1E-7339381IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-6340385IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
MEENGNHFKE QGNVSNSITR PAPLQIDSCG DASVEKMPDC GHVSEEIHTN VKDEDIDSPG  60
TATSKFVESL SSGKPDSPSD MPKNVESSGV VDAIQSTNIE VKCTVPGLFQ EEMTGASVCE  120
DGPMLEENKN EQPGSSDCSV YADGENICDI ILGSNKESAE QASEVFNKLL PRDLHRIDIS  180
RVANVLCCQN DSLIKQKFVR RKQFLRFKER VLTLKFKAFQ HLWKEDLRLL AIRKYRAKSQ  240
KKSESSLRTT CNGYQKHRSS IRSRFSSPAA GSLSLVPTME IVNFTSKLLC DSQVKVYRDF  300
LKMPALMLDN REKMASRFIS NNGLVEDPCA VEKERAMINP WTPEEREIFM DKLATFGKDF  360
RKIASFLDYK TTADCVEFYY KNHKSDSFEK LKKQHDFSKQ GKASTNTYLV TSGKRNRKMN  420
AASLDILGEA SEMAAAAQVK QF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_C2e-143073891294NUCLEAR RECEPTOR COREPRESSOR 2
4a69_D2e-143073891294NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006485885.10.0PREDICTED: uncharacterized protein LOC102608361 isoform X3
TrEMBLA0A067DZP50.0A0A067DZP5_CITSI; Uncharacterized protein (Fragment)
TrEMBLV4VB500.0V4VB50_9R
STRINGVIT_13s0019g04010.t011e-153(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM52602744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.11e-90MYB family protein